DPCstruct | MC31290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9B6D1 | 94-228 | DEEEMEMRNKVVEDLKTALRTQPMRFVTRFIELDGLTCLLNFLRSMDYETSESRVHTSVIGCIKALMNNSQGRAHVLAHPQSINTIS… |
| A0A822C9Q1 | 1-113 | MRFVTRFIELEGLTCLLNFLKSMDYDTAESRIHTSVIGCIKALMNNSQGRAHVLAHPESINIISQSLRTENIKTKIAVLEILGAVCL… |
| A0A663EQD6 | 63-199 | None |
| A0A3M7QRP8 | 63-197 | None |
| A0A6I9IRB1 | 93-224 | None |
| A0A2R7W4S5 | 97-231 | None |
| A0A6P8H7I6 | 112-248 | None |
| A0A6I9YNH9 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.