DPCstruct | MC31285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 299 |
|---|---|
| Mean domain length (aa) | 167 ± 23 aa |
| Standard deviation of domain lengths | 22.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 30.00 |
| Assigned Pfam label(s) | PF00082- CL0287- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257M4R8 | 10-153 | ELINPEARVRFDLDVTGRQLEWQWITRDAAWLVYDPRQTGKVTSAIQMFGNRSFLLFCTDGYEALDLLDDNGDHSISGSELSGLSLW… |
| F3BQ73 | 127-289 | PIILDLDGDGLSYTKLDNSPYLFDVNNDGIRDKLSWPTKGNAVLFADWNGSGIIDKRTEFMFSLFSPKKSATDLEGLMTFDYDSNNV… |
| A0A7C2IL67 | 452-624 | None |
| A7I388 | 564-676 | None |
| A7I2L2 | 418-532 | None |
| A7I2K7 | 720-897 | None |
| A7I2K5 | 211-398 | None |
| A7I0Z0 | 323-462 | None |
| A0A0Q9YTR4 | 1017-1193 | None |
| A0A2A4VG81 | 34-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.