DPCstruct | MC3128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 430 ± 48 aa |
| Standard deviation of domain lengths | 48.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9P3N3 | 2-386 | PTILWHVGTASVVGFNDALMAARATTIVKEQIQADKLPPHPFPLPSLRDPKVSLDELMAVFDLQHLAECLEYKQCHKTDWATDNDLT… |
| A0A1F5LDU6 | 1-398 | MASLVSLPIDCIIRILQSCDKLSQAIALSSTCKHLHSVYSSSSSGVIRHVGPREVFAFNEALITTRATRIVVEYFDKGQFPPQPFPL… |
| J3PGF1 | 176-610 | None |
| A0A0S7DLH9 | 1-463 | None |
| A0A167BY62 | 256-687 | None |
| A0A167MWV1 | 3-362 | None |
| Q0CS69 | 1-382 | None |
| A0A397GH87 | 1-454 | None |
| A0A0C4E5S9 | 108-639 | None |
| G2Q9Y6 | 1-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.