DPCstruct | MC31279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3MW28 | 181-252 | ACNGFTPNPHACPDGFRCRLPEHVTDLPGKCLQQCGGFAGIVCEDANALCVDDPTDGCDPHHGGADCGGLCV |
| A0A6A6JG51 | 27-137 | TLASCPPISPPQTLSTLTTTKQPPTPTPTNPICGGGRAGYHECPSGLTCIKDPRDPGCGPACDGLGICVEDKMCGGFAGLPCNDGRK… |
| Q2GMJ9 | 15-97 | None |
| A0A7C8R3F5 | 28-138 | None |
| A0A7D5UWU3 | 58-197 | None |
| A0A1G4BR16 | 57-189 | None |
| A0A4Z1NTP8 | 178-276 | None |
| A0A1J9RIR1 | 729-847 | None |
| A0A1I2CSD6 | 218-341 | None |
| A0A177D4I7 | 392-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.