DPCstruct | MC31277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8XCM5 | 409-512 | YDKSLFVQTQQLQNKISKQNRVQGSQAISLGGNVTLMENVTVRGDLCTVQVGNFCFLEKNVVVRPGRKNFKGGINHFPIRIGHRVVI… |
| A0A2G7G098 | 2-122 | PPKVAKGEYIETDTGNKISRRSQIHGTQHIILGGKTVIQGEAVIRGDLYRTSTSSSASGDQGGQQPATATPSVAITIGRYSYISKQA… |
| A0A194Q169 | 1-113 | None |
| A0A067D207 | 549-644 | None |
| A0A433Q677 | 125-233 | None |
| A0A0J9V903 | 39-117 | None |
| A0A365NKZ0 | 2-107 | None |
| A0A0K6G8T7 | 297-395 | None |
| A0A0B2W014 | 8-109 | None |
| A0A081CBT9 | 11-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.