DPCstruct | MC31276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.44 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF10650- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6J7H6 | 1-126 | MFKSYRYHPNYSQDVAGGFLSLTYSHQIDPEKPLCRFEAVGGTCNDPHCDGQHFREMKISGDKLLVQLGTANPGKTPEERQQWNDGL… |
| A0A0W4ZP94 | 629-751 | FHAFRYHPHFLSWVKGGFLSRTYSTRSDPNKKVCVFETAGGVCNDDSCKFLHFKEIGQTYDQFLIEMSSFPVGETEEERQNYFSGLR… |
| G2Q5J2 | 1080-1202 | None |
| F0ZT44 | 148-270 | None |
| A0A0J9XAP7 | 563-678 | None |
| A0A428TMC5 | 706-830 | None |
| G3JAM7 | 823-964 | None |
| B6K7Q2 | 616-738 | None |
| A0A3N4LGD2 | 1-117 | None |
| A0A2C5X0L8 | 956-1068 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.