DPCstruct | MC31275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 226 ± 45 aa |
| Standard deviation of domain lengths | 45.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545UZ09 | 4-155 | LEITNAQKQRMQRVADGLLAIYKTLARMRYLDPSWIEEGPHNHAIERLISRYRRAGVRDDIIYLYSVLPYVNTELCPRGVDFYEGSA… |
| A0A6A6J544 | 8-239 | DYSEDATVAAFRDYYRFLTMMYLDESLIQEPPEGGWPHITPDRWKGFDKTEEVFSLLRHLPYVTEKDGTMFTAPEGPFANYSEFPDC… |
| A0A2H1GPX5 | 2-214 | None |
| Q2GWN1 | 13-222 | None |
| A0A166M2R4 | 6-245 | None |
| A0A6A5SXB6 | 42-316 | None |
| A0A6A7AJE5 | 219-473 | None |
| A0A146I0F2 | 131-385 | None |
| A0A6A5Y8K8 | 29-299 | None |
| A0A6A5UWA0 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.