DPCstruct | MC31270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8E741 | 7-92 | TPDHPLIDDYALITRMPIDATHEALVAAGTTTIGTEAAVEYLCDPATLMHIRQKIASSSHEDAYELILHIRIVDEVPMHADIVAVR |
| A0A2V9VL98 | 95-201 | AVVNLHPRSGEPPLFLGSPSNIPLTEDYAVVALMRGMNPTESVLMLGGTSTLGTQAAVEYVCHEDSLVQLLNRLKIPSTGEMKPFEV… |
| A0A7J2R823 | 32-111 | None |
| A0A850Q3L8 | 26-132 | None |
| A0A7Y5RCU1 | 86-164 | None |
| A0A812ITU8 | 916-1007 | None |
| A0A7C2J6G8 | 134-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.