DPCstruct | MC3127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.27 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | CL0105- CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5TN52 | 330-453 | ADTRAQAIEQLKNVLSQTRLNGISTNLDYAHSVISDERFEQMQIWTRLLDDFDYVPNVIEVLQAGTQSSIQDFPGRVGYWDIGVPPS… |
| A0A1F5L7D2 | 5-135 | IIASGKDRATAIRKISLALEKPTVIGVEMNLRYLPQTMTWNAFTTGELTTNTFNRFPSQAEGVETIEAGSDTHIHVVPERQGLCHIG… |
| A0A2N6NK53 | 296-420 | None |
| A0A485CW87 | 1-134 | None |
| A0A485D142 | 1-124 | None |
| A0A2P9HYH8 | 32-160 | None |
| M2QVK2 | 1-124 | None |
| U4UNC5 | 850-969 | None |
| B5I525 | 151-274 | None |
| A0A663ASB6 | 64-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.