DPCstruct | MC31264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 171 ± 13 aa |
| Standard deviation of domain lengths | 13.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094FIZ5 | 3-186 | GNFQQMGNAGGNQVMMHQSQAQFQAQQNAIQNVLLQNIQQQTQTSTLSGWRANIPITERLGQVWHIVTQLRLTNPNNVTQDIQKMCG… |
| M1VX00 | 1-137 | MVANTQKKAGSGQMASQQPQRSSATVPLHLRVYQKILDDSYTTPNSMAWQLGTNFTERMGQTMNLISSMTMAMHGIDHAGAAEFGCS… |
| A0A1L7WEU9 | 270-442 | None |
| A0A175VT59 | 1-182 | None |
| U7Q451 | 5-173 | None |
| A0A0A2V6R8 | 180-355 | None |
| R1EN11 | 1-163 | None |
| H1UXV6 | 1-172 | None |
| F0U8X1 | 1-181 | None |
| A0A5N6DWE0 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.