DPCstruct | MC31263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 153 ± 12 aa |
| Standard deviation of domain lengths | 11.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6Y6W0 | 1-128 | MDETLPDSKAITVTAEERSKAFPVAVITHFVVQLSDKRLDSIIQSVPFWVFIGKTRSKALFDDEEQLEWLNAVRVRTRESIAFTNTQ… |
| G2QZN6 | 27-184 | RGVDSRAAIDAAVPEVRATTDVHLNNFEKSTVTHVVIQVTISRQVQIFKYIGYQYDWAVPSPFWDFLGRIASKAIFDDQVDLRELNF… |
| A0A1L7W760 | 21-177 | None |
| A0A1J7JWD4 | 20-165 | None |
| A0A179IFP2 | 16-179 | None |
| A0A1V6RWY4 | 1-164 | None |
| A0A370PV75 | 1-147 | None |
| A0A0A2IMB6 | 1-165 | None |
| G3XX18 | 87-250 | None |
| A0A168EVK3 | 33-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.