DPCstruct | MC31261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 203 ± 30 aa |
| Standard deviation of domain lengths | 30.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6XUU0 | 259-448 | VADTRAKRVGRAAVGVPEAVYIDGISSMTQDWSPDEIIYSRRIVGVNDSMAGSTRKIVLRPIAQDKWHPNMRCVSCIYWSGQQEYYI… |
| A0A1Y2AQX7 | 4-149 | SYRSQEEWVSKRRLVQFWRRQEGTAIFATCRPLPQHDYPQQQNSIIISCIFREEKNTCYVTSVDAIYLLEALVGNRFTVEEKNRIRR… |
| A0A369JP69 | 205-410 | None |
| A0A1R0H103 | 357-609 | None |
| A0A4T0I6K5 | 388-625 | None |
| G9NXH5 | 4-173 | None |
| A0A139HPV8 | 455-667 | None |
| A0A0L0NV44 | 1-179 | None |
| A0A5N6X9X2 | 14-163 | None |
| A0A1X2GK43 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.