DPCstruct | MC31258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 187 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 41.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6XMD1 | 2-206 | RLIATLNLMALAMSQVSAHGLITSVNGSNGVNMPGLTVIDGTPRGCPSAACGAQKDTGIIRDGEFESKMATPLGRTLGGGPIDPGRV… |
| B6HWG6 | 8-165 | SLLLLATQAAAHGLITRIMGANGVEMPGLTVVDGTPRDCPSAVCGGQKDTAVIRDQEMGSIKASALGRTLISGPVDPKRVIMNFMTP… |
| A0A0A1T733 | 40-227 | None |
| A0A1B8ARJ9 | 9-188 | None |
| A0A842YUJ8 | 3-200 | None |
| A0A0G4N380 | 240-422 | None |
| A0A6P8B651 | 105-315 | None |
| T4ZZW9 | 5-198 | None |
| A0A0A2V766 | 8-187 | None |
| W7HZ56 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.