DPCstruct | MC31254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 391 ± 69 aa |
| Standard deviation of domain lengths | 68.61 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3I527 | 6-399 | LWCSYRGTQVSTYLLSSIHMALEKFFLENFKNADSKVLESWLLFLLRNTKSASISAVVTSIVLAFPEKTFNVAKVLFQTKDFFRFDM… |
| A0A1E4QRM3 | 1-530 | MVRDLSNHGTTGWRQIANITRQNHGTPIPVTIAFPWGEQRFWGDWPAYNWQLGQLGAQPLECAFLALSYWAFRQVEAGRPVDEVIQL… |
| A0A415FFS4 | 312-704 | None |
| A7BRD4 | 141-448 | None |
| A0A0F3GJ60 | 481-941 | None |
| A0A2N5X6E0 | 253-641 | None |
| A0A6L6H8N6 | 316-782 | None |
| A0A373ZXS2 | 1-378 | None |
| A0A086FAV6 | 1-295 | None |
| A0A554VAS6 | 511-807 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.