DPCstruct | MC31252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 146 ± 21 aa |
| Standard deviation of domain lengths | 21.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6Z8W0 | 1-132 | MDPRMMHVTIRHTDWWFWENEEPLRLSWDWVQALLDSADLRNTEIIKLELETLDYKVDQLEPILEKIRQLESLEYKTHLIDGKPAKS… |
| A0A5N5Q4H6 | 312-460 | RVFAQMYKLEDGSLATLLGTRGLRPRRVTLTIRHSDWWFWEDDELLRVEGQKWLQGVCRVLEDSVREVTIELESLERKKDQVDEIAK… |
| A0A139H6D5 | 106-299 | None |
| A0A7S8HRQ3 | 161-283 | None |
| A0A2T2PA18 | 135-289 | None |
| A0A3N4LN06 | 185-314 | None |
| T5AHG1 | 133-280 | None |
| A0A1Y6LDF2 | 163-350 | None |
| A0A2P8A2V5 | 6-124 | None |
| E2LTB9 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.