DPCstruct | MC31251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 5.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5TFW6 | 1-98 | MTLDYKRFRTAQLARFARNRNLDVEVRPRQERGCYLRALIDADNDATFRFFDLPAEMRNTVYEHLLTLRDLNHGWRCYPEILATCKQ… |
| A0A3M6YZI0 | 1-110 | MTLPRYGINYNSFKVAELRRLIRAKGGNCRSSERKSTCLILLRRLDENATFNFMDLPPEMRNFVYRELLNWSDESSFYGCFPRILQA… |
| A0A0F4GFB0 | 1-106 | None |
| A0A3M7HGY0 | 1-107 | None |
| A0A1V8SBP0 | 97-199 | None |
| A0A139HDT7 | 5-107 | None |
| M2YU77 | 53-151 | None |
| A0A4T0BAK0 | 100-203 | None |
| A0A6A6D4H8 | 1-119 | None |
| A0A3M7CXS6 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.