DPCstruct | MC31249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370AQC3 | 4-100 | EIENVRQVPGEDNRKWFVDENTDLIVWYDSSEERITGFQLCYDKKSVQRCLTWQLKEGGKTLLSADGRYSKRRVIRLFNSISAELPP… |
| A0A6I2GTB7 | 12-142 | LGRSLREIDPSSLQQEQGEDPVRWFLGDSGTELFAWGVPGAPPRHLQLVFFRVSLEWTREQGLRTGSFDAQSSTSGGRYDPYLMTLG… |
| A0A7Y5T202 | 2-134 | None |
| A0A1F9MWV0 | 8-134 | None |
| A0A1F9N3N6 | 14-161 | None |
| A0A4Q6ETT1 | 110-230 | None |
| A0A2E1Q3Q0 | 1-158 | None |
| G0GF75 | 21-152 | None |
| A0A3A0BVU1 | 35-160 | None |
| A0A202DKA1 | 67-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.