DPCstruct | MC31247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 460 ± 93 aa |
| Standard deviation of domain lengths | 92.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812W7D4 | 81-567 | LDDTQVLVTGHSMGGHGCFVFASHFPDLLLGAACASGWPSLNSYSGDSHSGLLDGTRRGLLEEARFEHAADFLHENLKGVPMLVIYG… |
| A0A538RYE2 | 74-511 | IDPNRMVLRGFSMGGAGTWQLGLHTPARWCVLGPGAGFTTTHGYVKDLPDKLPTEQEACLHIYDAVDYAENAFNVPVVAYAGALDPQ… |
| A0A813FVQ8 | 97-700 | None |
| A0A2A5DQU8 | 499-855 | None |
| A0A2A5DNT3 | 231-651 | None |
| A0A3L7NH84 | 647-1155 | None |
| A0A3L7P7E7 | 699-1126 | None |
| A0A7V0XEQ9 | 26-454 | None |
| A0A3A4NK99 | 212-748 | None |
| A0A661WW83 | 518-880 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.