DPCstruct | MC31243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 333 |
|---|---|
| Mean domain length (aa) | 412 ± 79 aa |
| Standard deviation of domain lengths | 79.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.48 |
| Pfam Score | 54.34 |
| Assigned Pfam label(s) | CL0532- PF11038- CL0144- PF11040- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812TW46 | 45-472 | CASCAKGYAISDSSVLLCTRCPTKWWQQALQWLCMLGKHVLPFALAAKSALQGLDEKDRVQEEAKRSAVLINQLLSFATVTGGLLTV… |
| A0A2C5XGN8 | 195-583 | FRYLPLIILLFSALAVVFAGVFSPWGATNIFHWTSNYGRDTDLLRLVTPGFGDCLQYIQFVVLTGGLSLSYPGFYQPVVSQAAWSAL… |
| A0A812YKD7 | 54-428 | None |
| V5AEB6 | 63-389 | None |
| V5A2D6 | 187-566 | None |
| A0A7S0AT33 | 522-877 | None |
| A0A7S0Z2F5 | 182-458 | None |
| W4KM39 | 34-427 | None |
| A0A2P6NZB6 | 850-1188 | None |
| A0A2P6NJL5 | 655-1018 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.