DPCstruct | MC31241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 519 ± 57 aa |
| Standard deviation of domain lengths | 57.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9C5I0 | 173-675 | VSPPVGSENLQVGDFVLKLYLEDGGLMMVQGCRAEDAPDLSRAVRVPRAEEKTEERDLRVLPVIFDSAEERWRTLHEAVPEYEEVDF… |
| A0A812T9M5 | 11-590 | REQKVADDAPFVYPTVNISQDKFVPAQKVVEIFAIFWAFDRTRDIAALIYAHDPVGRAILANFKRQAQIQAAILGEGAVLDTETYHW… |
| A0A812WLX4 | 12-591 | None |
| A0A812PY67 | 101-556 | None |
| A0A812KWH1 | 2-490 | None |
| A0A812I3G4 | 331-779 | None |
| A0A812NLU4 | 3-559 | None |
| A0A812NE82 | 24-633 | None |
| A0A813LPQ2 | 2-427 | None |
| A0A813ENN3 | 228-757 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.