DPCstruct | MC3124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 409 ± 107 aa |
| Standard deviation of domain lengths | 107.38 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4QQQ4 | 27-495 | NLMHLAHQTRLPDRGEEKLRRAAKLTELLVERSVKGLSTLARETRRWLRSAKRQEIDQRPIARLQNPESQARYAGYMVKFVCYALRF… |
| B8PE79 | 2-377 | TGWADYLDELDLLKSRRAIRDLVSFTQLPTAKEPVLQELEDWVWHYITWIHDSYVTKAPYLVRRMILHCPIDESNGEAFRPLPKHQC… |
| A0A0J9W1K7 | 211-805 | None |
| A0A2K0TSH2 | 27-322 | None |
| A0A2P4Z8K7 | 2-254 | None |
| A0A094KC30 | 2-317 | None |
| A0A0H2R3F2 | 347-612 | None |
| A0A6S6VX12 | 163-561 | None |
| A0A6A4GII3 | 423-1173 | None |
| A0A178ARL3 | 30-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.