DPCstruct | MC31238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 130 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812Y5E0 | 435-563 | RGGSAEMVRRLIGLRADMDFQMNVARDFKAFSRLLFAGKSLQYRLGRATALSTLAYHLHGSTPLMQAIRSAQFEAAAALIAAGARLD… |
| A0A812T227 | 1-141 | MLHRGGSAEIVSRLIEAEADVNDRFTTPVCSVLGVMLRTLSLRHAWRTSALSAYAYHHFGATPLMSSILTGTFEVTAILLGTGASTE… |
| A0A812VMY4 | 487-603 | None |
| A0A1Q9DDY1 | 492-613 | None |
| A0A813BVB5 | 1-128 | None |
| A0A1Q9DSK6 | 1044-1178 | None |
| A0A812QNS5 | 475-602 | None |
| A0A812YNQ9 | 486-625 | None |
| A0A812JR24 | 511-647 | None |
| A0A1Q9EYD7 | 580-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.