DPCstruct | MC31233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 64.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812J4F0 | 6-119 | LFKTPEYSVKQPPDPVVCKPPANGILCAPSASGKTVLLVSMILAQYRGCFERIYIFSPSVEVDSAWQPVKEYIRDELGVNTDREQCW… |
| A0A1Q9DVR4 | 157-263 | RHWPGQTRVKLFPTAEYTSTQPRDPIVPRVPCTGIFLGPSKSGKTVALISAILDQHMTGGGDSVFERIYIFSPSIEIDDAWKPVKGF… |
| A0A812L8L3 | 41-154 | None |
| A0A1Q9EU99 | 3-91 | None |
| A0A812TQ28 | 5-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.