DPCstruct | MC31231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 132 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S1RCI9 | 3-110 | VLDAVLVVVFSTFGRGAHSEGLGVAQVWGTAWPFLVGLAVGWLVLLAGRREPSSIGSGVLLWLATLVVGMVIRGLGDGRVPHWSFMI… |
| A0A1S2GZC5 | 2-133 | TDRTWGWLAAVIDVVLIVVFALIGRSSHGETNSLGALWTTAYPFLAGWAIAYVTSGAWARPLRAWPTGIVAWILTVFVGMAIRVATG… |
| A0A3L7WJ43 | 4-127 | None |
| A0A4Y1QTD9 | 293-441 | None |
| A0A7L5AJT1 | 1-126 | None |
| A0A0G4HX28 | 173-309 | None |
| A0A543IJR8 | 3-114 | None |
| A0A5J4YRR5 | 584-712 | None |
| A0A535R7A1 | 108-249 | None |
| A0A7J7QJV6 | 811-1017 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.