DPCstruct | MC31229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 30.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9V740 | 2-79 | VMASLENAMASTGGFCVGRSYVVGHQRLSGLGYCFSASLPPLLATAASEGLRIIDEEPERVARVQRLAVAVHRGLEAA |
| A0A6P3HE30 | 97-178 | IISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRG |
| A0A834BAZ6 | 1-54 | None |
| A0A3P6TIU5 | 2-97 | None |
| A0A6A2XRD4 | 18-125 | None |
| A0A351NEV4 | 1-80 | None |
| A0A0D3A1I8 | 136-211 | None |
| A0A1I8GFX1 | 1012-1103 | None |
| A0A7Z7IN89 | 62-149 | None |
| A0A5A7N2V5 | 24-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.