DPCstruct | MC31228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 224 ± 40 aa |
| Standard deviation of domain lengths | 40.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF02965- PF02310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9V065 | 166-364 | TERWLSPILGYECSSLTDKTTRDAFIADLSEEYEEVRQEHYESLKERRFTTLAMARTKRMVVDFEKFPPVKPSFLGRRKIVDFDLRE… |
| A0A377LPM8 | 1-146 | MTLQAARDNDLAFDWASYTPPVAHRLGVQEVTANIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEEAKRLFKDANDMLDKLSAE… |
| A0A7Y1TVK6 | 264-475 | None |
| A0A0B1PH14 | 11-289 | None |
| A0A439EYK2 | 2-221 | None |
| A0A556TWT1 | 824-1127 | None |
| A0A2K8U605 | 509-719 | None |
| A0A7V2T6H8 | 142-430 | None |
| A0A0D2MET8 | 292-528 | None |
| G6C3S5 | 185-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.