DPCstruct | MC31224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 19.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9UUL4 | 1-131 | MVKSGLDPSNNSDTNVPRVSQYRLATHLTMAFLLYSLFLYNGISHFVTPQVQLTNLPKFGMLRGLSHSAKALVFITAFMGAFVAGLD… |
| A0A078AXH9 | 177-352 | KKSLFALLAFGSLQGVIGWWMVKSGLVDKNKTIELDKTPRVSPYRLTVHGYSAYIIYGVGVWLAMNLLRRPQEAVINLANMADHASM… |
| S9X679 | 186-383 | None |
| A0A833T276 | 199-386 | None |
| A0A7C9DSH9 | 1-120 | None |
| A0A5P1EX26 | 242-404 | None |
| A0A820YA36 | 410-579 | None |
| A0A1V9Z703 | 171-338 | None |
| A0A2D4PKA8 | 8-139 | None |
| A0A2E0MIW6 | 38-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.