DPCstruct | MC31223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444SDS5 | 134-271 | KDYSGIQLVKKIANIQNDSIKKAEVKAYFKDYEEAEKLYLESDRIDMAISLRRRLGDWFRVHQLLKTGGAGNDKQVEEALNNIGQIY… |
| A0A2G9UTB3 | 1-144 | MRDYCGLRFCKRIEDIQDPKLKKAEIFVHLGRASDAEKEYLEQDRRDLAIDMHKKADEWLRVLRLVSASSTAADDKQRIEALTNVAD… |
| A0A2H2IQW8 | 317-436 | None |
| A0A4U5NH26 | 43-182 | None |
| C1MKL3 | 143-255 | None |
| A0A1Y2HUD8 | 755-896 | None |
| A0A7S2HGN5 | 2-134 | None |
| A0A812SPJ7 | 7-136 | None |
| A0A484BZQ1 | 487-621 | None |
| A0A0D6LG96 | 485-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.