DPCstruct | MC3122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 21.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5WYY9 | 159-334 | WNDNEIYKEIKMKPLIEGSHEARRTGIQRLRAVMGVYYYMRDPTIALYFKREVNRIQERLNLIEAQMATHPRIVRERGGGIRTYDAY… |
| A0A4Q4P4G3 | 7-205 | QQLFNQKRTKYGFYIQIRDKKKMKDLIEGRTKQKDLKNLNLSPADQTRIVIQRLRETIGALKYMQDKKISKIFVDQKNRMGAMIGHI… |
| A0A6A5Y252 | 232-395 | None |
| A0A2V1CXH6 | 6-182 | None |
| A0A6A5V8E4 | 148-303 | None |
| G3JUF0 | 606-778 | None |
| A0A6A6HUW7 | 19-216 | None |
| A0A6G1JU93 | 67-270 | None |
| A0A177C2S1 | 404-630 | None |
| A0A1Y2LKT4 | 10-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.