DPCstruct | MC31219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 158 ± 12 aa |
| Standard deviation of domain lengths | 12.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844LNV2 | 18-155 | TGCANDEEVARELIDYYNNDWLASQIMKKENIGPKQNELLRLEDESNERASMLVEEEIIPSMKKVLDYLHNVELEHAEIKELHQINV… |
| R5VQ51 | 1-178 | MKRRLLMTMMAMVLVFSLAGCGSKKDEPTTAASTEAESEVKDELIQFIGTDIPKVEADEAAVMKSYNSYFAEGATIDTDTLLKDLTD… |
| A0A1H9GZW2 | 12-173 | None |
| A0A2W0CG74 | 21-173 | None |
| A0A7M1SCE6 | 1-169 | None |
| A0A1R1BAC7 | 1-172 | None |
| A0A7T6ZD89 | 1-164 | None |
| A0A7S7EU51 | 18-167 | None |
| A0A0M0G4G5 | 41-210 | None |
| A0A398BGK3 | 15-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.