DPCstruct | MC31216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 157 ± 17 aa |
| Standard deviation of domain lengths | 17.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7W3V1 | 13-128 | KARGWVRLPPPSPIFSAYRLPKPLNVFGQTTSTVAFKGSAMMAVLDLPDATALGAAQGVTNVLAGTGRFMGERLVDDSTRVDPESGF… |
| A0A6G8S744 | 7-175 | LKTLISPLVLTVSIQAMASSHDSFSTENLKNLIECKASVDDFRAFTEDYEQHFKQLGWQRKDDANQPFLYIYQNKQPLDVYGHPTQE… |
| A0A2C9ZYS7 | 5-166 | None |
| A0A3S0QTW6 | 1-186 | None |
| A0A272EY85 | 6-152 | None |
| A0A355EWS1 | 1-175 | None |
| A0A2D2DNA1 | 1-154 | None |
| A0A516SGL4 | 5-142 | None |
| A0A1D9BDJ5 | 1-162 | None |
| A0A5J5FS82 | 14-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.