DPCstruct | MC3121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 133 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A807NH29 | 215-304 | CYLENAGYREGQLFTEAMRELLAPLENPRYLIEGKKIVLTVPERFGRNKQIANLFLNELNQSSLPKCQLVYTRNPEGRQKLVTYRMR… |
| A0A1E7JZ30 | 20-171 | AYAVAEGLCEAGLVPRGAAAVSLTPDAEGAYRIGLEGVPEAASECFVTALDEAVSPVGDPRYLLPRYVPDRQGWRAGHRATRNKLSH… |
| A0A090WPN9 | 3-149 | None |
| A0A1V3XM11 | 302-458 | None |
| A0A1G7WL96 | 136-270 | None |
| A0A2M8BBW2 | 676-831 | None |
| A0A2H1JTJ6 | 279-420 | None |
| A0A651I1K5 | 153-282 | None |
| A0A3B9E542 | 493-619 | None |
| A0A4R0U188 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.