DPCstruct | MC31209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 150 ± 36 aa |
| Standard deviation of domain lengths | 36.10 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 49.38 |
| Pfam Score | 96.25 |
| Assigned Pfam label(s) | CL0110- PF01092- CL0369- CL0431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0AMX9 | 1-191 | MKLNVSYPATGCQKLFEVNDEHKLRVFYEKHMGQVVEADILGDEWKGYMLRISGGNDKQGFPMKQGVLTHDRVRLLLKKGHSCYRPR… |
| A0A6B0RBP1 | 1-152 | MKLNISFPATGCQKLIEVDDERKLRTFYEKCMATEVAADALGEEWKGRVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPR… |
| A0A5B6WNY2 | 42-169 | None |
| A0A4W2GN31 | 3-123 | None |
| A0A7J2IZ52 | 4-113 | None |
| A0A2B7WH00 | 341-530 | None |
| A0A7R9A7N9 | 291-487 | None |
| A0A821H856 | 6-114 | None |
| L5JL76 | 1-106 | None |
| B8D6E3 | 122-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.