DPCstruct | MC31206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 253 ± 28 aa |
| Standard deviation of domain lengths | 28.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0023- CL0396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0QZ21 | 8-292 | ASATIMGYFLRLLQLFSTCLAFSLVATTGTWRETIGNWSMFIWCFCFVVTLLTFIVELCGLQFLWPFSWDDFLINYASYSTLLCLSA… |
| A0A835ZVU9 | 2-253 | GNWSMFTWCFCFSVTLIILIVELGGLQVRFPLSWRNFPITYACYAALFCLSSSIIYPTTYVQFLSHGRSRDHAIAATAFSCIACLAY… |
| A0A212CS65 | 412-692 | None |
| A0A212CSD8 | 249-491 | None |
| B2KIL4 | 2-238 | None |
| A0A384AFB2 | 24-257 | None |
| H3HBC3 | 1-335 | None |
| A0A6G0HV81 | 131-382 | None |
| A0A6G0HYJ1 | 2-217 | None |
| A0A4W2GL14 | 1-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.