DPCstruct | MC31205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 151 ± 29 aa |
| Standard deviation of domain lengths | 29.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | CL0661- PF12777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4J2I3 | 27-142 | IKPDFNATDINGMQNLELGIPQYGKIFYANKNILLVTTTGGEDDRLNIDEGLLISQSKIMLNQISLPQLNAAATITLYNISFNSPKI… |
| A0A1E3QXH3 | 15-176 | VDEVRPVEVVEELADEEDIDDDGYWMSPKLSSLARLSKKELSEVNGFTVGRKNYGKIEFSAPVDLTTISLEDITNNLVVFTPKSCII… |
| A0A7S2R6I5 | 1-111 | None |
| C1MLH2 | 182-364 | None |
| A0A388KYV9 | 1003-1168 | None |
| A0A061D7Y0 | 859-1028 | None |
| A0A1F4RLH2 | 596-739 | None |
| A0A2W1BM74 | 59-242 | None |
| A0A7J2KLZ7 | 552-669 | None |
| A0A1Q9C9V4 | 752-899 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.