DPCstruct | MC31204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 291 ± 56 aa |
| Standard deviation of domain lengths | 55.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3QXD8 | 5-318 | LENKLKQELKEIAISLGLPAKTNNTKGQLLEMIKDHFLEHEHFSEDSRYAAFFPIAESETVVIAVEELASEDEDNGKTDTGKNVGDE… |
| A0A1V2L2X8 | 3-361 | LRGLNKATLVDMAQQLSLNDEGTKVVLEERLQEHFDNHPELEENATFAKFVAFRRKQSPVKVTQIDEIAAVVEDDDKPASSPGRLFS… |
| A0A4Q2D5N3 | 10-337 | None |
| F8Q9V1 | 135-346 | None |
| I2GXH9 | 1-349 | None |
| A0A093XT29 | 2-196 | None |
| A0A261Y563 | 224-450 | None |
| A0A0L6WWP7 | 8-335 | None |
| A0A1V2LLQ9 | 376-715 | None |
| A0A137QEX7 | 10-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.