DPCstruct | MC31202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9EBS4 | 11-128 | LGLLADRLTMALLVLGIVLGLVIGILTGLGPPIAIALALPFTFYMDTVPSMVLLLGSYSAAIYGGSISAIAVDIPGTGAAIATVQDG… |
| A0A6N4VGQ6 | 5-115 | DWLLQGFAEAATPTNLLYAVIGVLLGTAVGVLPGIGPAMTVALLLPITYNVSPSAAFIMFAGIFYGGMYGGSTTSILLNTPGESSSV… |
| A0A7W4UQP4 | 50-139 | None |
| A0A395YH52 | 30-152 | None |
| A0A268HXU7 | 1-121 | None |
| A0A829W7J3 | 2-108 | None |
| A0A0K2QWV6 | 1-137 | None |
| A0A6L5DDP3 | 77-197 | None |
| A0A6B3JXB5 | 2-108 | None |
| A0A455V0R1 | 5-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.