DPCstruct | MC31201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 186 ± 25 aa |
| Standard deviation of domain lengths | 24.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 15.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4IQ17 | 74-245 | VGDVVRHVERELANHVDGYDQHRFDSQTDEDVVRALVRELSIEPITLDYDGAQKNVVETRISVRDHFEGTVEVPGLRVSKTFPFTGD… |
| A0A6N4VFQ3 | 2-162 | NDNALLNAPAQDVIDELVEAGSVRCPELDIDSAYQIEPTEVDQQYQQFGERYSRHVTRFVLVVPFDGEKDVFTFCPDHSTTVRPSVL… |
| A0A1E4MV06 | 12-202 | None |
| A0A7V5DEF7 | 4-181 | None |
| A0A844SAX8 | 10-198 | None |
| A0A6L7TQU5 | 12-210 | None |
| A0A6I4TER0 | 9-160 | None |
| A0A5J4QES3 | 1-220 | None |
| A0A536G503 | 8-144 | None |
| A0A1J5KK70 | 8-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.