DPCstruct | MC31200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 131 ± 34 aa |
| Standard deviation of domain lengths | 34.37 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4VE99 | 1-125 | MLGIAACSAPEPALGGTTASVSIDGNNSGVRAVRCHQTGPTWYIQTPEQDSGFTAVLQTGSDISASSVNFRDVEGFTGSFWNDNIGD… |
| A0A378TEW6 | 69-178 | SATVTIDGQEQNIEGQSVCTNLGGNIQIAIGNATQGIGAQVTEADPPVVKQVGLGNVNGVAIGYTEGLPGGEATAEKDGNTYKITGS… |
| A0A6I0FC43 | 77-207 | None |
| A0A4R7ALA1 | 1-107 | None |
| A0A3R8PNY4 | 1-221 | None |
| A0A1R4JGZ0 | 1-169 | None |
| S2ZZB4 | 1-181 | None |
| A0A1A0M2W2 | 342-472 | None |
| A0A7I7MDF3 | 120-237 | None |
| A0A846X6B6 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.