DPCstruct | MC3120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7I5T3 | 4-132 | LDEFFQELESHCPKKAIATFLNSEGECFVVDLIREADAVKYGYDRHIKALLSQKISQGCTPYGSLILRSFTTEIDRLTRLPYKELRG… |
| A0A1E7JXP2 | 149-307 | QAGPRLGDTFGADRFVKAAELLNRLLDALGQGSHSLVCSVRTPVAPLAAVLRAECVGERGADTHLGDRRPGLVWMDDDEALRFCAVL… |
| A0A2N0JMP6 | 177-315 | None |
| A0A830GWT4 | 6-140 | None |
| A0A117SRR0 | 2-161 | None |
| A0A3A5MJL9 | 44-180 | None |
| A0A7J3TE84 | 12-156 | None |
| A0A0J6XJ14 | 2-132 | None |
| A0A061A1P0 | 132-268 | None |
| A0A174TDR7 | 108-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.