DPCstruct | MC312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 186 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1U7D1 | 4-166 | IIIGLCVASIVWAQHPYKKHFVSFVTQNDGYVFPMIDRYYTAGHSLLYASAEESGGGIIGWIDGNHSFNLAISQSIYTAKSKFATTP… |
| A0A4R6GIY3 | 21-205 | VNSIYSQEFNTGLLSHNLSTDHYIRLSYDNDYFGGDDDDYTQGFNIEVVHSVFKDNPLNKLLFSLKESQDKYGVALEHATFTSNTIS… |
| A0A524KUR1 | 38-223 | None |
| A0A6M8WFE3 | 39-239 | None |
| A0A7T5R1N9 | 301-512 | None |
| A0A388QS85 | 13-197 | None |
| A0A2P2DNU9 | 4-147 | None |
| A0A3R8T9K0 | 4-190 | None |
| A0A7Y3TDF2 | 27-212 | None |
| A0A6N2CII4 | 197-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.