DPCstruct | MC31198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9H487 | 1-147 | MGSAISLRKVEETAPALVNLYKSAAVSLEKHGLGGQRAAVHLVLDHSGSMRDHYKDGTVQALAERVLGLSAHLDDDGTVPITVFSTD… |
| A0A5P0YQL4 | 316-442 | GSAISLEKVRESAPELVSLYKAAAVSLEKHGLAGRRAAVYLVLDRSGSMRRYYKDGTVQHLAEQVLGLSAHLDDDGTVPVVFFSTDI… |
| A0A7Z2GPQ3 | 80-208 | None |
| V4N2Y0 | 155-285 | None |
| A0A1S2PYL4 | 122-249 | None |
| A0A6N6X7V3 | 1-134 | None |
| A0A1W1UPB1 | 189-313 | None |
| A0A8A8Q4C0 | 80-200 | None |
| A0A1M6CXM8 | 17-145 | None |
| A0A2G6JCP5 | 9-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.