DPCstruct | MC31190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1C3W2 | 91-167 | MRLLAQPSYTGAYDIDQDPLWTHTPQALPIDVLAWYQCDHLGTPQELTDHTGQIAWSAQYKAWGEVKEQRSEWAQRQ |
| A0A844GGW4 | 6-97 | LHPAGPVHTDAIQGVKVPAWGQHNPYDPDRDPLLKEGPEPSAPHAVYYYHADHLGTPQALTDEQGRLALEMDYRARGEAREVIAEAA… |
| A0A371YJZ1 | 2-87 | None |
| A0A103L9T5 | 61-141 | None |
| A0A6H3TMA2 | 3-79 | None |
| N9RVJ9 | 6-88 | None |
| A0A6P2Y8H3 | 27-106 | None |
| A0A6L5DCC6 | 269-345 | None |
| A0A7U1DJA2 | 340-416 | None |
| A0A0Q6MW65 | 74-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.