DPCstruct | MC3119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 355 ± 45 aa |
| Standard deviation of domain lengths | 45.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 30.00 |
| Assigned Pfam label(s) | CL0689- CL0126- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5QVR4 | 321-662 | NNDNIFFAYFDLSTNADVNKDTDGDGLLDEWESNGYDHDSDGVVDVNLPGMGANPKHKDIFIEIDWMRNASHSHKPTLGVMSRVISA… |
| A0A5S3VI93 | 514-866 | DDDNDGIPDCAEQEGATFAGLPLYEWGARAGVRDIFIEVDYMESNDPGIQLHRQALDSVKAAFAAQNIAMHFDAGDLYHQAEGISPA… |
| A0A1W1XWG1 | 477-835 | None |
| A0A1Q7KX43 | 120-562 | None |
| A0A0Q9SYQ2 | 360-707 | None |
| A0A517NZL5 | 291-625 | None |
| A0A7C2Q4T0 | 230-645 | None |
| K0BAE2 | 193-487 | None |
| A0A2V7D257 | 351-728 | None |
| A0A654M0U4 | 53-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.