DPCstruct | MC31189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 461 ± 46 aa |
| Standard deviation of domain lengths | 46.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433UXI9 | 6-380 | AKEVTNLYLYGTTTTSKNLVNDSLIRPLTLPKVTSVNVDKKDFMAGAGRFAVGATFELVQKFFNPGSSTPLVPAGSYTKQEVANKLK… |
| A0A844GG50 | 10-492 | ANGITSSYLYGSENVPVDWLDGKRRDFSPVETRIPVRDYMATVGRFVNASFFPVIEKFLNPSFQNSYQIPPGEYNKEQIYAIFGINS… |
| A0A420FYM4 | 1-458 | None |
| A0A5C0DU18 | 5-390 | None |
| H8GI81 | 5-483 | None |
| A0A2S6HGB5 | 1-510 | None |
| A0A7W4TUH7 | 12-493 | None |
| A0A380N2U6 | 12-499 | None |
| A0A421DIZ0 | 6-497 | None |
| B9D543 | 46-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.