DPCstruct | MC31188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2U9F4 | 107-221 | RLDAFGLKARLTGDLKVVQDKQGLGLNGQINIPSGRFHAYGQDLIVRKGELLFSGPPDQPLLNIEAIRNPDATEDDVIAGVRVTGTA… |
| A0A844GE63 | 2-115 | ELTGMVRVTSSPGQAPAARGQVKVVKGRYKAYGQELDIQTGVITFAGPLDNPTLNVRANRRLSAVGAGVEVTGSVSSPRVRLVADEA… |
| A0A2V7SY78 | 79-232 | None |
| A0A7C7V939 | 641-791 | None |
| A0A849Y0X1 | 347-476 | None |
| A0A377APH2 | 1-137 | None |
| A0A2H0LE29 | 244-367 | None |
| A0A1J4VAY5 | 935-1064 | None |
| A0A227JPX4 | 324-454 | None |
| A0A376YEP4 | 107-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.