DPCstruct | MC31187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3QZF7 | 2-132 | NLNIKQDKLFREALQCVEHGLYRSAHVTSFAALMDFIHEWIANDVSRLSAIQTNYTAWNIKQASDFRDQKDHTLFEVMKKQAFITNG… |
| A0A2J6MR22 | 6-143 | LRKQLATITNETTRTFVEESIKALEARLYRSAIVLSWVGAVSVLYDHVLSTCLNNFNAEAVRREAKWKAAKTQDDLARMKEFDFLQV… |
| A0A1B2HSF2 | 1-165 | None |
| A0A6N9CZA6 | 35-183 | None |
| A0A0Q6WZS3 | 60-207 | None |
| J7Q9I9 | 95-232 | None |
| A0A433UJZ9 | 9-159 | None |
| A0A800J4Y3 | 2-148 | None |
| A0A521PSR7 | 3-140 | None |
| G8LQ91 | 37-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.