DPCstruct | MC31185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3EI24 | 18-96 | SKNEFKKYLQTIWFQLYPRKNHVLDSCAFEHTFLGEIYKKKVMGMHNWIRMAYLQETEKAQYNGYYSLIAFHLEQGDQA |
| A0A0M0JS49 | 1-87 | MQFTYEFLKEHGKDARTKHLRQPHDMQTLVSELWFAPYTRCRPNDSSGFEHVFVGEERHGKVIGLHNWIQFYLEEKKGKINYSGWVG |
| A0A7M4E7S3 | 76-161 | None |
| A0A6J8E3U2 | 101-179 | None |
| A0A0N5A709 | 412-483 | None |
| A0A7J6B9E4 | 140-225 | None |
| A0A7R9AE86 | 44-115 | None |
| A0A0N4VUD9 | 129-209 | None |
| A0A0M3HGC5 | 9-88 | None |
| A0A7R9D6H8 | 204-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.