DPCstruct | MC3118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 392 ± 41 aa |
| Standard deviation of domain lengths | 40.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 15.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655XDD8 | 5-368 | PTANAQPNLGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMNQGSYQRPPSLQDGKNYQNW… |
| A0A5S3VFN7 | 2-343 | PIDTEAAPLAGHPLIGIEVEGVGTISSQWNNEDIIQAANFHDVFKRTPLVRSRSYANFRGVYITPEDSDNFGKSSPAELVSKPHRIN… |
| A0A419VS87 | 100-475 | None |
| A0A831UCF8 | 90-516 | None |
| A0A6A5UWV8 | 28-417 | None |
| A0A2V1DKQ6 | 9-389 | None |
| A0A1H9MRZ7 | 1-326 | None |
| A0A418VPM4 | 197-552 | None |
| A0A510UN79 | 390-770 | None |
| A0A2A2HUM8 | 244-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.