DPCstruct | MC31176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 307 ± 76 aa |
| Standard deviation of domain lengths | 76.26 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 76.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.02 |
| Pfam Score | 83.40 |
| Assigned Pfam label(s) | PF04375- PF09731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1M220 | 18-234 | VVAFVAGQQTSTATRLAAVSAVASDGGSALVARIDAVEARLARMEAGRSNERLIAGLLNLQGATASSRPWPRELQVVRDLAGPGQLP… |
| A0A1F2ZLD6 | 5-290 | KKSVPKKQWWLVKLVVFLSLIFFGYFGYEYWKSEREKRLAAKHEVEKFDNVESEIFDLSKEYQDEYRDDLSDLTINELREKGAEFIY… |
| A0A7W4CJJ2 | 142-613 | None |
| A0A1Y2HWI6 | 2-253 | None |
| A0A356F6N5 | 15-325 | None |
| K8EUL2 | 10-291 | None |
| A0A1A8YR68 | 584-971 | None |
| A0A7R9YBK3 | 54-375 | None |
| A0A6G6Y114 | 48-273 | None |
| A0A257J1I4 | 49-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.